Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorella protothecoides Cytochrome b6 (petB)

This Recombinant Chlorella protothecoides Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P13347

Expression Region

1-215

Origin

Chlorella protothecoides (Green microalga) (Auxenochlorella protothecoides)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKIYDWFEERLEIQSIADDISSKYVPPHVNIFYCFGGITFTCFLVQVATGFAMTFYYRP TVAEAFTSVQYLMTQVNFGWLIRSIHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVT GVLMAVCTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGQVLLELLRGGVAVGQSTL TRFYSLHTFVLPLFTAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chmp2b (NM_026879) Mouse Tagged ORF Clone
MG202330 10 µg

Chmp2b (NM_026879) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), 0.2mg/mL
BNUB2462-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), 0.2mg/mL

Sign In for Pricing
View Details
1,2,3,6,7,8-Hexahydropyrene
TRC-H294445-1G 1 g

1,2,3,6,7,8-Hexahydropyrene

Sign In for Pricing
View Details
SPRR2A (C-term) Rabbit Polyclonal Antibody
AP54034PU-N 400 µL

SPRR2A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB523241 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
BAX Antibody
OC-142-01 50 μL

BAX Antibody

Sign In for Pricing
View Details