Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sarcospan (Sspn)

This Recombinant Mouse Sarcospan (Sspn) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Sarcospan, K-ras oncogene-associated protein, Kirsten-Ras-associated protein

UniProt

Q62147

Expression Region

1-216

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRKPSPRAQELPEEEARTCCGCRFPLLLALLQLALGIAVTVLGFLMASISPSLLVRDTP FWAGSIVCVVAYLGLFMLCVSYQVDERTCVQFSMKVFYFLLSALGLMVCMLAVAFAAHHY SLLAQFTCETSLDSCQCKLPSSEPLSRAFVYRDVTDCTSVTGTFKLFLIIQMVLNLVCGL VCLLACFVMWKHRYQVFYVGVGLRSLMASDGQLPKA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Integrin beta-3 ELISA Kit
MBS7256159-01 48 Well

Mouse Integrin beta-3 ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin beta-3 ELISA Kit
MBS7256159-02 96 Well

Mouse Integrin beta-3 ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin beta-3 ELISA Kit
MBS7256159-03 5x 96 Well

Mouse Integrin beta-3 ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin beta-3 ELISA Kit
MBS7256159-04 10x 96 Well

Mouse Integrin beta-3 ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-6834-5p miRNA Inhibitor
CIH2331-01 10 nmol

Hsa-miR-6834-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-6834-5p miRNA Inhibitor
CIH2331-02 20 nmol

Hsa-miR-6834-5p miRNA Inhibitor

Sign In for Pricing
View Details