Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C30D10.09c (SPBC30D10.09c)

This Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C30D10.09c (SPBC30D10.09c) spans the amino acid sequence from region 1-217.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C30D10.09c

UniProt

O14355

Expression Region

1-217

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLLMLEQISLASSVVATTVLVAPVLSTIINLLTNFGQRIFIAADSSKSTSMEFLSTIIG AGYPIYKTYLLLELPSKRSQLLPKAFQLRNEEHKSIEEERRRLMAYWCVYGCVTAAESIL GRFLSWVPFYSTSKIVFWLWLLNPRTQGAAFIYASYISPFLSDHKAAINNFLEKLVQFTT RQPLVLNAWALVKSLIDKLPKGDVEAPGSDADTKKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNB2 Peptide (AAP36758)
AAP36758-100UG 100 µg

CACNB2 Peptide (AAP36758)

Sign In for Pricing
View Details
Htr4 Mouse siRNA Oligo Duplex (Locus ID 15562)
SR413041 1 Kit

Htr4 Mouse siRNA Oligo Duplex (Locus ID 15562)

Sign In for Pricing
View Details
Gpr34 Mouse shRNA Lentiviral Particle (Locus ID 23890)
TL509853V 500 µL Each

Gpr34 Mouse shRNA Lentiviral Particle (Locus ID 23890)

Sign In for Pricing
View Details
Lentiviral human MAPK8IP1 shRNA (UAS) - Lentiviral human MAPK8IP1 shRNA (UAS) plasmid
GTR15163363 1 Vial

Lentiviral human MAPK8IP1 shRNA (UAS) - Lentiviral human MAPK8IP1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Vmn2r37 Double Nickase Plasmid (m2)
sc-423641-NIC-2 20 µg

Vmn2r37 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
1-Olein-3-Arachidin
MBS392959-01 25 mg

1-Olein-3-Arachidin

Sign In for Pricing
View Details