Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic (CA2)

This Recombinant Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic (CA2) spans the amino acid sequence from region 100-316.

Product Specifications

Product Name Alternative

Beta-carotene hydroxylase 2, chloroplastic, EC= 1.14.13.129

UniProt

O49814

Expression Region

100-316

Origin

Capsicum annuum (Bell pepper)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEKLARKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGEVPFSEMFGTFALSVG AAVGMEFWARWAHKALWHASLWHMHESHHKPREGPFELNDVFAIINAVPAIALLDYGFFH KGLIPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKF NGVPYGLFLGPKELEEVGGLEELEKEVNRRTRYIKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Goat Affinity Purified Antibody to Human IgD
RAF-004-2 2 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human IgD

Sign In for Pricing
View Details
Pancreatic Polypeptide (PPY) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]
TA813060BM 100 µL

Pancreatic Polypeptide (PPY) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
PRKACA Human Knockdown Lysate
LY300491 100 µg

PRKACA Human Knockdown Lysate

Sign In for Pricing
View Details
EvaGreen®, 2000X in DMSO
#31019 1x 50 µL

EvaGreen®, 2000X in DMSO

Sign In for Pricing
View Details
Recombinant Human Retbindin/RTBDN Protein (His Tag)
PKSH032993-01 10 µg

Recombinant Human Retbindin/RTBDN Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Retbindin/RTBDN Protein (His Tag)
PKSH032993-02 50 µg

Recombinant Human Retbindin/RTBDN Protein (His Tag)

Sign In for Pricing
View Details