Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic (CA2)

This Recombinant Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic (CA2) spans the amino acid sequence from region 100-316.

Product Specifications

Product Name Alternative

Beta-carotene hydroxylase 2, chloroplastic, EC= 1.14.13.129

UniProt

O49814

Expression Region

100-316

Origin

Capsicum annuum (Bell pepper)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEKLARKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGEVPFSEMFGTFALSVG AAVGMEFWARWAHKALWHASLWHMHESHHKPREGPFELNDVFAIINAVPAIALLDYGFFH KGLIPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKF NGVPYGLFLGPKELEEVGGLEELEKEVNRRTRYIKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF432 Human Gene Knockout Kit (CRISPR)
KN401171 1 Kit

ZNF432 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Scrg1 Mouse Gene Knockout Kit (CRISPR)
KN515401 1 Kit

Scrg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TNFRSF18 Human Gene Knockout Kit (CRISPR)
KN219997RB 1 Kit

TNFRSF18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Fluorocinnamic Acid
TRC-F588643-5G 5 g

2-Fluorocinnamic Acid

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF594 conjugate, 0.1mg/mL
BNC940803-500 1x 500 µL

Cytokeratin 8 (KRT8/803), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase-1 Microplate Assay Kit
RDSM192 100 Assays

Caspase-1 Microplate Assay Kit

Sign In for Pricing
View Details