Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Probable D-methionine transport system permease protein metI (metI)

This Recombinant Pasteurella multocida Probable D-methionine transport system permease protein metI (metI) spans the amino acid sequence from region 1-217.

Product Specifications

Product Name Alternative

Probable D-methionine transport system permease protein metI

UniProt

Q9CK96

Expression Region

1-217

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPRIWELVGLSTLETLYMGFIATLFAIVIGLPIGLLAFLTGKGEILENRRANQVLNVII NIGRSVPFIILLIILLPFTRLVVGTTLGTTAAIVPLSVSAIPFFARLTANALLEIPSGLT EAAKSMGATNWQIVTKYYLPESIPILINGITLTLVALIGYSAMAGAVGGGGLGNLAITYG EHRNMIYVKWIATIIIVLIVMLSQKLGDHLAERFDHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF405S conjugate, 0.1mg/mL
BNC041970-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details