Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Mb2670 (Mb2670)

This Recombinant Uncharacterized membrane protein Mb2670 (Mb2670) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Mb2670

UniProt

P63912

Expression Region

1-218

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGA AVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRF IALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIAL VIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YB1 (YBX1) Rabbit Polyclonal Antibody
TA367779 100 µL

YB1 (YBX1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R21 Antibody
KC-28621-01 50 μL

PPP1R21 Antibody

Sign In for Pricing
View Details
PPP1R21 Antibody
KC-28621-02 100 µL

PPP1R21 Antibody

Sign In for Pricing
View Details
PPP1R21 Antibody
KC-28621-03 1 mL

PPP1R21 Antibody

Sign In for Pricing
View Details
IL-6 Antibody
F42217-0.08ML 0.08 mL

IL-6 Antibody

Sign In for Pricing
View Details
PAK2 Rabbit Polyclonal Antibody
AP21121PU-N 100 µg

PAK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details