Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein Mb2670 (Mb2670)

This Recombinant Uncharacterized membrane protein Mb2670 (Mb2670) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Mb2670

UniProt

P63912

Expression Region

1-218

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGA AVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRF IALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIAL VIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF640R conjugate, 0.1mg/mL
BNC402153-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR4B1 Antibody
8G583-AAT 50 µg

OR4B1 Antibody

Sign In for Pricing
View Details
B7 H6 (NCR3LG1) Human Gene Knockout Kit (CRISPR)
KN232774BN 1 Kit

B7 H6 (NCR3LG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 7 (ANGPTL7) ELISA Kit
RD-ANGPTL7-Mu-01 96 Tests

Mouse Angiopoietin Like Protein 7 (ANGPTL7) ELISA Kit

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 7 (ANGPTL7) ELISA Kit
RD-ANGPTL7-Mu-02 48 Tests

Mouse Angiopoietin Like Protein 7 (ANGPTL7) ELISA Kit

Sign In for Pricing
View Details
Human DGKD activation kit by CRISPRa
GA105641 1 Kit

Human DGKD activation kit by CRISPRa

Sign In for Pricing
View Details