Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6 (petB)

This Recombinant Prochlorococcus marinus Cytochrome b6 (petB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

A2CBR0

Expression Region

1-218

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNSSPVYDWFQERLEIQAIADDVSSKYVPPHVNIFYCLGGITLVCFLVQFATGFAMTFY YKPTVTEAYSSVSYLMSDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDFMVELLRGGESVGQ STLTRFYSLHTFVLPWLLAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI10G2]
CF806575 100 µg

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI10G2]

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR560180 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details
Slc8a3 Mouse Gene Knockout Kit (CRISPR)
KN516204 1 Kit

Slc8a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Oxythiamine Monophosphate
TRC-O878515-5MG 5 mg

Oxythiamine Monophosphate

Sign In for Pricing
View Details
IMMP1L (C-term) Rabbit Polyclonal Antibody
AP52203PU-N 400 µL

IMMP1L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vimentin (VM452), CF568 conjugate, 0.1mg/mL
BNC680452-100 1x 100 µL

Vimentin (VM452), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details