Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6 (petB)

This Recombinant Prochlorococcus marinus Cytochrome b6 (petB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

A2BUV5

Expression Region

1-218

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNSSSVYDWFQERLEIQDITDDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTQAYNSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPIIGDFMVELLRGGESVGQ STLTRFYSLHTFVLPWSLAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RAB5A Antibody
RC-7009-01 50 μL

Recombinant RAB5A Antibody

Sign In for Pricing
View Details
Recombinant RAB5A Antibody
RC-7009-02 100 µL

Recombinant RAB5A Antibody

Sign In for Pricing
View Details
Recombinant RAB5A Antibody
RC-7009-03 1 mL

Recombinant RAB5A Antibody

Sign In for Pricing
View Details
Desmocollin-2/3 (rDSC2/3437), CF488A conjugate, 0.1mg/mL
BNC883437-100 1x 100 µL

Desmocollin-2/3 (rDSC2/3437), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slc6a20a Mouse Gene Knockout Kit (CRISPR)
KN516177 1 Kit

Slc6a20a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF405S conjugate, 0.1mg/mL
BNC043046-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details