Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6 (petB)

This Recombinant Synechococcus sp. Cytochrome b6 (petB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q3AMC3

Expression Region

1-218

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSSPVYDWFQERLEIQDIADDIGSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVAEAYKSVEYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVTMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDFMVELLRGGESVGQ ATLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD58 Antibody
RC-16480-01 50 μL

Recombinant CD58 Antibody

Sign In for Pricing
View Details
Recombinant CD58 Antibody
RC-16480-02 100 µL

Recombinant CD58 Antibody

Sign In for Pricing
View Details
Recombinant CD58 Antibody
RC-16480-03 1 mL

Recombinant CD58 Antibody

Sign In for Pricing
View Details
Ribonuclease Inhibitor (RNH1) (NM_203389) Human Over-expression Lysate
LC404330 20 µg

Ribonuclease Inhibitor (RNH1) (NM_203389) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM49 Antibody
OC-2154-01 50 μL

TRIM49 Antibody

Sign In for Pricing
View Details
TRIM49 Antibody
OC-2154-02 100 µL

TRIM49 Antibody

Sign In for Pricing
View Details