Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6 (petB)

This Recombinant Prochlorococcus marinus Cytochrome b6 (petB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q46H42

Expression Region

1-218

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTEAYSSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WITGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVIGDFMVELLRGGESVGQ STLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM2 antibody
70R-4103 50 ug

PGAM2 antibody

Sign In for Pricing
View Details
UGT1A10 (NM_019075) Human Tagged Lenti ORF Clone
RC202144L4 10 µg

UGT1A10 (NM_019075) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDK16 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
15692067 1.0 µg DNA

CDK16 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human L-Selectin (Recombinant)
22060410-1 2 µg

Human L-Selectin (Recombinant)

Sign In for Pricing
View Details
RpmF Antibody
orb826944 2 mg

RpmF Antibody

Sign In for Pricing
View Details
Rat SLC30A3 shRNA Plasmid
abx990668-01 150 µg

Rat SLC30A3 shRNA Plasmid

Sign In for Pricing
View Details