Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Putative glutamine transport system permease protein glnP (glnP)

This Recombinant Rickettsia typhi Putative glutamine transport system permease protein glnP (glnP) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Putative glutamine transport system permease protein glnP

UniProt

Q68XN8

Expression Region

1-218

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKYLIKFYPKILFIIEGTLVTLKYSIIAVILGLVIGMLLAICKVNKNCVLRLFANFYTS IFRGTPLLVQLSIIYFAAPYIISIKFSVFMAGVISFALNSGAYVSEVIRAGINTIDKGQF EAAEALAIPKFLIMKDIILPQAINNIFPSLVNELINLIKESAIISMLGEMDLMRRAQIVS IETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-500 1x 500 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details