Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6 (petB)

This Recombinant Prochlorococcus marinus Cytochrome b6 (petB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q7VDK9

Expression Region

1-218

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTEAYNSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDFMVELLRGGESVGQ TTLTRFYSLHTFVLPWTLAIFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS509596 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL
BNC400853-500 1x 500 µL

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxy Polystyrene
H50056008.25G 25 g

Carboxy Polystyrene

Sign In for Pricing
View Details
Guanosine 3',5'-Cyclic Monophosphate-13C5 Sodium Salt
TRC-G837963-0.25MG 0.25 mg

Guanosine 3',5'-Cyclic Monophosphate-13C5 Sodium Salt

Sign In for Pricing
View Details
2,3-Dicyano-5,6-diphenylpyrazine
TRC-D437750-500MG 500 mg

2,3-Dicyano-5,6-diphenylpyrazine

Sign In for Pricing
View Details
Mmp3 Mouse Gene Knockout Kit (CRISPR)
KN310182LP 1 Kit

Mmp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details