Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6 (petB)

This Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6 (petB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q7V2X6

Expression Region

1-218

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDSSSVYDWFQERLEIQDITDDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTQAYNSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPIIGDFMVELLRGGESVGQ STLTRFYSLHTFVLPWSLAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), CF568 conjugate, 0.1mg/mL
BNC683129-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENSA (Center) Rabbit Polyclonal Antibody
AP51434PU-N 400 µL

ENSA (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), 0.2mg/mL
BNUB2335-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL
BNC040696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP23 (MMP23B) Rabbit Polyclonal Antibody
AP06232PU-N 100 µg

MMP23 (MMP23B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QK1 (QKI) Rabbit Polyclonal Antibody
TA380596 100 µL

QK1 (QKI) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details