Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Inner membrane protein YghB (yghB)

This Recombinant Salmonella typhimurium Inner membrane protein YghB (yghB) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Inner membrane protein YghB

UniProt

P0A1F4

Expression Region

1-219

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVIQDIIAALWQHDFAALANPHVVSVVYFVMFATLFLENGLLPASFLPGDSLLLLAGAL IAQDVMHFLPTIGILTAAASLGCWLSYIQGRWLGNTRTVKGWLAQLPAKYHQRATCMFDR HGLLALLAGRFLAFVRTLLPTMAGISGLSNRRFQFFNWLSGLLWVTVVTSFGYALSMIPF VKRHEDQVMTFLMILPVALLVAGLLGTLVVVIKKKYCNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF568 conjugate, 0.1mg/mL
BNC680053-100 1x 100 µL

HCG-alpha (HCGa/53), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details