Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dedA (dedA)

This Recombinant Protein dedA (dedA) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Protein dedA, Protein DSG-1

UniProt

P0ABP7

Expression Region

1-219

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIYFLIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVVTPFLPGDSLLFVAGA LASLETNDLNVHMMVVLMLIAAIVGDAVNYTIGRLFGEKLFSNPNSKIFRRSYLDKTHQF YEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIGALLWVLLFTYAGYFFGT IPMVQDNLKLLIVGIIVVSILPGVIEIIRHKRAAARAAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDEF1IT1 AAV siRNA Pooled Vector
56381161 1.0 µg

DDEF1IT1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Vibrio scophthalmi Probe-based qPCR Kit
MK1F529-01 48 Test

Vibrio scophthalmi Probe-based qPCR Kit

Sign In for Pricing
View Details
Vibrio scophthalmi Probe-based qPCR Kit
MK1F529-02 50 Tests

Vibrio scophthalmi Probe-based qPCR Kit

Sign In for Pricing
View Details
Recombinant Human CDKN2A Protein, His (Fc)-Avi-tagged
CDKN2A-569H 50 µg

Recombinant Human CDKN2A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Mesocricetus auratus Cytochrome P450 11B2, mitochondrial (CYP11B2)
MBS1434200-01 0.02 mg (E-Coli)

Recombinant Mesocricetus auratus Cytochrome P450 11B2, mitochondrial (CYP11B2)

Sign In for Pricing
View Details
Recombinant Mesocricetus auratus Cytochrome P450 11B2, mitochondrial (CYP11B2)
MBS1434200-02 0.02 mg (Yeast)

Recombinant Mesocricetus auratus Cytochrome P450 11B2, mitochondrial (CYP11B2)

Sign In for Pricing
View Details