Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dedA (dedA)

This Recombinant Protein dedA (dedA) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Protein dedA, Protein DSG-1

UniProt

P0ABP7

Expression Region

1-219

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIYFLIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVVTPFLPGDSLLFVAGA LASLETNDLNVHMMVVLMLIAAIVGDAVNYTIGRLFGEKLFSNPNSKIFRRSYLDKTHQF YEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIGALLWVLLFTYAGYFFGT IPMVQDNLKLLIVGIIVVSILPGVIEIIRHKRAAARAAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Retinoblastoma protein phosphoserine 249/phosphothreonine 252 Antibody
3112 1 Each

Anti-Retinoblastoma protein phosphoserine 249/phosphothreonine 252 Antibody

Sign In for Pricing
View Details
I/EVP7/NL/RFLB/2.0MPL-400X600-1 Parking, Traffic & Road Signs (No Adhesive)
310307 1 Pack (1 Panel (s) x 1 Pack)

I/EVP7/NL/RFLB/2.0MPL-400X600-1 Parking, Traffic & Road Signs (No Adhesive)

Sign In for Pricing
View Details
Amyloid [11-28] Monoclonal Antibody
E53M01076 100 µL

Amyloid [11-28] Monoclonal Antibody

Sign In for Pricing
View Details
GATA2 Antibody
ABD6117 100 µg

GATA2 Antibody

Sign In for Pricing
View Details
Human SSMEM1 Pre-designed siRNA Set B
SI015825B 1 Each

Human SSMEM1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PK2 (Prokineticin 2) Chicken ELISA Kit
F9018 96 Tests

PK2 (Prokineticin 2) Chicken ELISA Kit

Sign In for Pricing
View Details