Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dedA (dedA)

This Recombinant Protein dedA (dedA) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Protein dedA, Protein DSG-1

UniProt

P0ABP7

Expression Region

1-219

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLIYFLIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVVTPFLPGDSLLFVAGA LASLETNDLNVHMMVVLMLIAAIVGDAVNYTIGRLFGEKLFSNPNSKIFRRSYLDKTHQF YEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIGALLWVLLFTYAGYFFGT IPMVQDNLKLLIVGIIVVSILPGVIEIIRHKRAAARAAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Desmocollin-2 Antibody (7G6) [mFluor Violet 500 SE]
NBP2-54519MFV500 0.1 mL

Mouse Monoclonal Desmocollin-2 Antibody (7G6) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Firefly Luciferase Recombinant Antibody, APC Conjugated
bsm-63023R-APC-01 20 µL

Firefly Luciferase Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Firefly Luciferase Recombinant Antibody, APC Conjugated
bsm-63023R-APC-02 100 µL

Firefly Luciferase Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
ANKFY1 Lentiviral Activation Particles (h)
sc-406658-LAC 200 µL

ANKFY1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Fra-2 (G-5) Alexa Fluor® 488
sc-166102 AF488 200 µg/mL

Fra-2 (G-5) Alexa Fluor® 488

Sign In for Pricing
View Details
Peptide tyrosine tyrosine polyclonal antibody
MBS565786-01 0.1 mL

Peptide tyrosine tyrosine polyclonal antibody

Sign In for Pricing
View Details