Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 54 (Tmem54)

This Recombinant Mouse Transmembrane protein 54 (Tmem54) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Transmembrane protein 54

UniProt

Q9D7S1

Expression Region

1-219

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCLRIGSLNVDEFRKVLMKTGLVLVVLGHVSFIAAAVLHGTMLRFVATTSDAVVLQYCAV DILSVTSAIVVIVAGISTIVLSRYLPSTPLRWTVFSLSVACALLSLTCALGLLASIAVTF ATKGRALLAACTFENPELPTLAPDCPFDPTRIYSSSLCLWAISLIFCLAESMSAVRCAQL MHGLLELRPWWGKSCHHTIQASPEPLDAHDLLSCASSCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF647 conjugate, 0.1mg/mL
BNC471828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS637261 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Optional Rod for Hotplate/Stirrer (H3770 Series)
H3770-ROD 1 Each

Optional Rod for Hotplate/Stirrer (H3770 Series)

Sign In for Pricing
View Details
ENTR1 (NM_001039707) Human Over-expression Lysate
LC421811 20 µg

ENTR1 (NM_001039707) Human Over-expression Lysate

Sign In for Pricing
View Details
CASP5 (p10, Cleaved-Ser331) Antibody
8L0159-AAT 50 µg

CASP5 (p10, Cleaved-Ser331) Antibody

Sign In for Pricing
View Details
TRRAP Rabbit Polyclonal Antibody
HA500431 100 µL

TRRAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details