Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sepia pharaonis Cytochrome c oxidase subunit 1 (COI)

This Recombinant Sepia pharaonis Cytochrome c oxidase subunit 1 (COI) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c oxidase polypeptide I

UniProt

Q957T2

Expression Region

1-219

Origin

Sepia pharaonis (Pharaoh cuttlefish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TLYFIFGIWSGLLGTSLSLMIRSELGKPGTLLNDDQLYNVVVTAHGFIMIFFLVMPIMIG GFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSAVESGAGTGWTVYPPLSSNL SHAGPSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGLQMERLPLFVWSVFITAILLL LSXPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF640R conjugate, 0.1mg/mL
BNC402561-100 1x 100 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF647 conjugate, 0.1mg/mL
BNC471384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF594 conjugate, 0.1mg/mL
BNC941118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details