Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-3 (Cldn3)

This Recombinant Mouse Claudin-3 (Cldn3) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-receptor 2

UniProt

Q9Z0G9

Expression Region

1-219

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALL CCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2,4-Dioxo-3,4-dihydropyrimidin-1(2H)-yl)acetic Acid
TRC-D485905-50MG 50 mg

(2,4-Dioxo-3,4-dihydropyrimidin-1(2H)-yl)acetic Acid

Sign In for Pricing
View Details
Rab11b Antibody
KC-522-01 50 μL

Rab11b Antibody

Sign In for Pricing
View Details
Rab11b Antibody
KC-522-02 100 µL

Rab11b Antibody

Sign In for Pricing
View Details
Rab11b Antibody
KC-522-03 1 mL

Rab11b Antibody

Sign In for Pricing
View Details
Human SPEM1 activation kit by CRISPRa
GA117776 1 Kit

Human SPEM1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS645982 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details