Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-3 (Cldn3)

This Recombinant Mouse Claudin-3 (Cldn3) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-receptor 2

UniProt

Q9Z0G9

Expression Region

1-219

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALL CCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FASTKD2 (NM_001136194) Human Over-expression Lysate
LC427842 20 µg

FASTKD2 (NM_001136194) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ANKRD55 Antibody
RN-035-01 50 μL

Recombinant ANKRD55 Antibody

Sign In for Pricing
View Details
Recombinant ANKRD55 Antibody
RN-035-02 100 µL

Recombinant ANKRD55 Antibody

Sign In for Pricing
View Details
Recombinant ANKRD55 Antibody
RN-035-03 1 mL

Recombinant ANKRD55 Antibody

Sign In for Pricing
View Details
S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF594 conjugate, 0.1mg/mL
BNC942591-500 1x 500 µL

S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human STING (TMEM173) activation kit by CRISPRa
GA117456 1 Kit

Human STING (TMEM173) activation kit by CRISPRa

Sign In for Pricing
View Details