Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat TLC domain-containing protein 1 (Tlcd1)

This Recombinant Rat TLC domain-containing protein 1 (Tlcd1) spans the amino acid sequence from region 28-247.

Product Specifications

Product Name Alternative

TLC domain-containing protein 1

UniProt

Q5U2T1

Expression Region

28-247

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RLPLPAHVQTDPLRTWRWHNLLVSFTHSIVSGIWALLCIWQTPEMLVEIETAWSVCGYLL VCFSAGYFIHDTVDIVVSRQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVS NIFLTLRMMMKINNAQDILLYKVNKYVNLVMYFLFRLAPQAYLTKFFLQYAGQRTLGTFL LSILLMLDVMILIYFSRLLRSDFCPERAPSRQQKDKFLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF405S conjugate, 0.1mg/mL
BNC042329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details