Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2214 (AF_2214)
This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2214 (AF_2214) spans the amino acid sequence from region 1-221.
Product Specifications
Product Name Alternative
Uncharacterized protein AF_2214
UniProt
O28069
Expression Region
1-221
Origin
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSQQIDPQQIDPELKSGQIKVLLEQYKILKNEIHLTSQKMTGNIRIGLIVLSLIGSYILH SLIKNEITKSVIDNTTDAVMYTISILLIIGLWTNVFSSLSAIARLGGYLIYLEKTINELI GKNLMIYESEFVPKFFTGSAILAYDLPNVLVFGCTSLFVISFLGYKVLVTINTPDFNLIL RSFIILILVISTILFLVNLFTILRVNKVKDEIVTFCTKKIK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details