Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ykoX (ykoX)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ykoX (ykoX) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ykoX

UniProt

O34908

Expression Region

1-221

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHKHETRELVAIEELVMSWIEAFKSLSYFGIFLALSIEFIPAEVVLPLAGYWVSKGDMT LAGVVLAGSLGGVAGPLTLYWIGRYGGRPFLERFGKYLFIKPEALDKSDNFFKKHGGFVA FSGRFLPGIRTLISIPCGIAKMNVWVFSLYTFIAMLPITFVYVYLGVKLGENWKAVGSIL DQYMLPIGIAILALFLLYLLMKKRKKRTHSEQLSVFLKNKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF40 (NM_014771) Human Recombinant Protein
TP762467 50 µg

RNF40 (NM_014771) Human Recombinant Protein

Sign In for Pricing
View Details
Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF405S conjugate, 0.1mg/mL
BNC043771-500 1x 500 µL

Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
THBS1 Polyclonal Antibody
E-AB-16211-01 20 µL

THBS1 Polyclonal Antibody

Sign In for Pricing
View Details
THBS1 Polyclonal Antibody
E-AB-16211-02 60 µL

THBS1 Polyclonal Antibody

Sign In for Pricing
View Details
THBS1 Polyclonal Antibody
E-AB-16211-03 120 µL

THBS1 Polyclonal Antibody

Sign In for Pricing
View Details
THBS1 Polyclonal Antibody
E-AB-16211-04 200 µL

THBS1 Polyclonal Antibody

Sign In for Pricing
View Details