Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-2 (Tspan2)

This Recombinant Mouse Tetraspanin-2 (Tspan2) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Tetraspanin-2, Tspan-2

UniProt

Q922J6

Expression Region

1-221

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGTMKDLSSEDKSPEYFYVGLY VLVGAGALMMTVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKDVAIRHV QSMYEEAYSDYLKDRARGNGTLITFHSAFQCCGKESSEQVQPTCPKELPGHKNCIDKIET VISAKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRDVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: left
CS804565 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Mouse Bub1 activation kit by CRISPRa
GA200453 1 Kit

Mouse Bub1 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Human MMP-8 (Matrix Metalloproteinase 8) ELISA Kit
E-UNEL-H0117-01 5x 96 Tests

Uncoated Human MMP-8 (Matrix Metalloproteinase 8) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MMP-8 (Matrix Metalloproteinase 8) ELISA Kit
E-UNEL-H0117-02 15x 96 Tests

Uncoated Human MMP-8 (Matrix Metalloproteinase 8) ELISA Kit

Sign In for Pricing
View Details
CCL2 / MCP-1 Recombinant Rabbit monoclonal Antibody
HA723691 100 µL

CCL2 / MCP-1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715642 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details