Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-2 (TSPAN2)

This Recombinant Human Tetraspanin-2 (TSPAN2) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Tetraspanin-2, Tspan-2, Tetraspan NET-3

UniProt

O60636

Expression Region

1-221

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLY VLVGAGALMMAVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHV QTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIET IISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRDVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARPP21 (NM_001025068) Human Over-expression Lysate
LC425474 20 µg

ARPP21 (NM_001025068) Human Over-expression Lysate

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-GS-I Antibody
AL-2401-2 2 mL

Unconjugated Rabbit Anti-GS-I Antibody

Sign In for Pricing
View Details
Mouse Actl7a activation kit by CRISPRa
GA200047 1 Kit

Mouse Actl7a activation kit by CRISPRa

Sign In for Pricing
View Details
Gastrokine 1 (GKN1) Rabbit Polyclonal Antibody
TA371894 100 µL

Gastrokine 1 (GKN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CENPA Recombinant Rabbit monoclonal Antibody
HA750578 100 µL

CENPA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details