Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-2 (TSPAN2)

This Recombinant Human Tetraspanin-2 (TSPAN2) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Tetraspanin-2, Tspan-2, Tetraspan NET-3

UniProt

O60636

Expression Region

1-221

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLY VLVGAGALMMAVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHV QTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIET IISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRDVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCN2 (Reticulocalbin 2, E6BP, ERC-55, ERC55, TCBP49) discontinued
213052-01 50 µL

RCN2 (Reticulocalbin 2, E6BP, ERC-55, ERC55, TCBP49) discontinued

Sign In for Pricing
View Details
RCN2 (Reticulocalbin 2, E6BP, ERC-55, ERC55, TCBP49) discontinued
213052-02 100 µL

RCN2 (Reticulocalbin 2, E6BP, ERC-55, ERC55, TCBP49) discontinued

Sign In for Pricing
View Details
RCN2 (Reticulocalbin 2, E6BP, ERC-55, ERC55, TCBP49) discontinued
213052-03 200 µL

RCN2 (Reticulocalbin 2, E6BP, ERC-55, ERC55, TCBP49) discontinued

Sign In for Pricing
View Details
Chicken MAX dimerization protein 1 ELISA Kit
MBS750281-01 48 Well

Chicken MAX dimerization protein 1 ELISA Kit

Sign In for Pricing
View Details
Chicken MAX dimerization protein 1 ELISA Kit
MBS750281-02 96 Well

Chicken MAX dimerization protein 1 ELISA Kit

Sign In for Pricing
View Details
Chicken MAX dimerization protein 1 ELISA Kit
MBS750281-03 5x 96 Well

Chicken MAX dimerization protein 1 ELISA Kit

Sign In for Pricing
View Details