Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein ORM1 (ORM1)

This Recombinant Saccharomyces cerevisiae Protein ORM1 (ORM1) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Protein ORM1

UniProt

P53224

Expression Region

1-222

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELDYQGTAEAASTSYSRNQTDLKPFPSAGSASSSIKTTEPVKDHRRRRSSSIISHVEP ETFEDENDQQLLPNMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMTYV IGSYVMFHLIKGTPFDFNGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAH YDLKLFSWNCFLTTFGAVVPKLPVTHRLRISIPGITGRAQIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS4 Rabbit Polyclonal Antibody (PerCP)
orb2553577 100 µL

BCAS4 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
HDAC4 (Ab-632) discontinued
318429 100 µL

HDAC4 (Ab-632) discontinued

Sign In for Pricing
View Details
ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 405)
MBS6296651-01 0.1 mL

ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 405)

Sign In for Pricing
View Details
ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 405)
MBS6296651-02 5x 0.1 mL

ERO1LB, CT (ERO1LB, ERO1-like protein beta, Endoplasmic oxidoreductin-1-like protein B, Oxidoreductin-1-L-beta) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Anti-PON2 Rabbit mAb
CMA4616-01 30 µL

Recombinant Anti-PON2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-PON2 Rabbit mAb
CMA4616-02 50 μL

Recombinant Anti-PON2 Rabbit mAb

Sign In for Pricing
View Details