Recombinant Schizosaccharomyces pombe Uncharacterized endoplasmic reticulum membrane protein C16E8.02 (SPAC16E8.02)
This Recombinant Schizosaccharomyces pombe Uncharacterized endoplasmic reticulum membrane protein C16E8.02 (SPAC16E8.02) spans the amino acid sequence from region 1-222.
Product Specifications
Product Name Alternative
Uncharacterized endoplasmic reticulum membrane protein C16E8.02
UniProt
O13737
Expression Region
1-222
Origin
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTYLSRSYSFYAAYHSNPVNIKIHQVCIPLLLLTALVLLHNFVITLINSKLQINVAHLVG LAYQIFYVTLDPLDGLLYSPVLYLFSYILPSKLFTIFSRSLVNRSAAVVHVICWILQFIG HGVFEKRKPALLDNLIQSLFIAPLFAFLETGPFVGYYPSVVSKIRANIKLKDVGENYPNL SEFLFPPSMVEDAVSGVVEDASQLSYCIRPLRLSDIDDGIVF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133316-AP 100 µL
SHC2 (SHC-transforming Protein 2, Src Homology 2 Domain-containing-transforming Protein C2, SH2 Domain Protein C2, Protein Sck, SHCB, SCK) (AP) discontinued
Sign In for Pricing
View Details 
MBS6364338-01 0.2 mL
YOD1, CT (YOD1, DUBA8, HIN7, OTUD2, Ubiquitin thioesterase OTU1, DUBA-8, HIV-1-induced protease 7, OTU domain-containing protein 2) (Biotin)
Sign In for Pricing
View Details MBS6364338-02 5x 0.2 mL
YOD1, CT (YOD1, DUBA8, HIN7, OTUD2, Ubiquitin thioesterase OTU1, DUBA-8, HIV-1-induced protease 7, OTU domain-containing protein 2) (Biotin)
Sign In for Pricing
View Details 