Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ML0287 (ML0287)

This Recombinant Uncharacterized membrane protein ML0287 (ML0287) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ML0287

UniProt

O69601

Expression Region

1-222

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTAIVALPPTLDPMFWIGPEGFFAAAMLPATLVIIFVETGLLFPLLPGESLLFTGGLLA TKGTIDIWVLSPSVAVVAVLGDQIGYLIGRRIGPALFKKENSRFFKQHYVTESHAFFEKH GRWTIILARFLPFMRTFTPVIAGLSYMSYPLYLGFDIVGGILWGGGVTVAGYFLGNVPFV RQNLEKIILGILFVSLLPALIAAWHGYRSQSRTAKSELALPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-ILF2-Neo Plasmid
PVT67718 2 µg

PCMV-EGFP-ILF2-Neo Plasmid

Sign In for Pricing
View Details
PRC discontinued
541283-01 30ul

PRC discontinued

Sign In for Pricing
View Details
PRC discontinued
541283-02 100 µL

PRC discontinued

Sign In for Pricing
View Details
Peroxin 3 (m) -PR
sc-152174-PR 10 µM - 20 µL

Peroxin 3 (m) -PR

Sign In for Pricing
View Details
PNPT1 (Polyribonucleotide Nucleotidyltransferase 1, Mitochondrial, 3'-5' RNA Exonuclease OLD35, PNPase old-35, Polynucleotide Phosphorylase 1, PNPase 1, Polynucleotide Phosphorylase-like Protein, PNPASE, DKFZp762K1914, OLD35, PNPASE, Old-35) APC
MBS6390033-01 0.1 mL

PNPT1 (Polyribonucleotide Nucleotidyltransferase 1, Mitochondrial, 3'-5' RNA Exonuclease OLD35, PNPase old-35, Polynucleotide Phosphorylase 1, PNPase 1, Polynucleotide Phosphorylase-like Protein, PNPASE, DKFZp762K1914, OLD35, PNPASE, Old-35) APC

Sign In for Pricing
View Details
PNPT1 (Polyribonucleotide Nucleotidyltransferase 1, Mitochondrial, 3'-5' RNA Exonuclease OLD35, PNPase old-35, Polynucleotide Phosphorylase 1, PNPase 1, Polynucleotide Phosphorylase-like Protein, PNPASE, DKFZp762K1914, OLD35, PNPASE, Old-35) APC
MBS6390033-02 5x 0.1 mL

PNPT1 (Polyribonucleotide Nucleotidyltransferase 1, Mitochondrial, 3'-5' RNA Exonuclease OLD35, PNPase old-35, Polynucleotide Phosphorylase 1, PNPase 1, Polynucleotide Phosphorylase-like Protein, PNPASE, DKFZp762K1914, OLD35, PNPASE, Old-35) APC

Sign In for Pricing
View Details