Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Cytochrome b6 (petB)

This Recombinant Synechocystis sp. Cytochrome b6 (petB) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q57038

Expression Region

1-222

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFLIQFATGFA MTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKP RELTWVVGVMLAVTTVTFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQLVTLMRGSE SVGQATLTRFYSLHTFVLPWAIAVLLLLHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-100 1x 100 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL
BNC941098-500 1x 500 µL

Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF594 conjugate, 0.1mg/mL
BNC942875-100 1x 100 µL

CD44 / HCAM Std. (HCAM/2875R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details