Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Protease prsW (prsW)

This Recombinant Bacillus licheniformis Protease prsW (prsW) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Protease prsW, EC= 3.4.-.-, Protease responsible for activating sigma-W

UniProt

Q65I04

Expression Region

1-222

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGIISAGLAPGIALLMYFYLKEKYESEPIHMVIRLFILGVLLVFPTMFIQYVLEKEHIS EGSFVVSFLTSGFLEEFLKWFLLMVSTFQHIDFDEHYDGIVYGTSLSLGFATLENILYLI GNGVEYAFMRALLPVSSHALFGVIMGFYIGKARFSDSKTKMKWLLCSLFIPALLHGLYDY ILLALKNWIYFMLPFMAFLWWFGLRKAKKARSVKTGGQPLQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H14 Rabbit pAb
E45R17988N 50 ul

ZC3H14 Rabbit pAb

Sign In for Pricing
View Details
c3030 kit epoxy ph/ec/tds/sal/res/o2
C3030TE 1 Each

c3030 kit epoxy ph/ec/tds/sal/res/o2

Sign In for Pricing
View Details
GK2 Polyclonal Antibody, HRP Conjugated
A50258-100 100 µL

GK2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)
MBS6228308-01 0.1 mL

IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)

Sign In for Pricing
View Details
IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)
MBS6228308-02 5x 0.1 mL

IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Usp24 shRNA (UAS) - Lentiviral mouse Usp24 shRNA (UAS) plasmid
GTR15303514 1 Vial

Lentiviral mouse Usp24 shRNA (UAS) - Lentiviral mouse Usp24 shRNA (UAS) plasmid

Sign In for Pricing
View Details