Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23 (TIM23)

This Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23 (TIM23) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM23, Membrane import machinery protein MIM23, Mitochondrial protein import protein 3, Mitochondrial protein import protein MAS6

UniProt

P32897

Expression Region

1-222

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF640R conjugate, 0.1mg/mL
BNC402250-500 1x 500 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF740 conjugate, 0.1mg/mL
BNC741236-500 1x 500 µL

PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details