Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23 (TIM23)

Mitochondrial import inner membrane translocase subunit TIM23, Membrane import machinery protein MIM23, Mitochondrial protein import protein 3, Mitochondrial protein import protein MAS6

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK