Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P28058

Expression Region

1-222

Origin

Prochlorothrix hollandica

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTKQVQESGVYKWFNDRLEIEAISDDISSKYVPPHVNIFYCLGGITLVCFIIQFATGFA MTFYYKPSVTEAFTSVQYLMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKNP RELTWITGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPLVGPLMVELIRGSA SVGQATLTRFYSLHTFVLPWFIAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm9733 Mouse shRNA Plasmid (Locus ID 751864)
TR517691 1 Kit

Gm9733 Mouse shRNA Plasmid (Locus ID 751864)

Sign In for Pricing
View Details
Rat Skic2 Pre-designed siRNA Set A
SI212904A 1 Each

Rat Skic2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TOB1 Antibody, HRP conjugated
MBS7105138-01 0.05 mg

TOB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
TOB1 Antibody, HRP conjugated
MBS7105138-02 0.1 mg

TOB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
TOB1 Antibody, HRP conjugated
MBS7105138-03 5x 0.1 mg

TOB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
TAK1 Rabbit pAb
E45R17586N 50 ul

TAK1 Rabbit pAb

Sign In for Pricing
View Details