Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

P28058

Expression Region

1-222

Origin

Prochlorothrix hollandica

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTKQVQESGVYKWFNDRLEIEAISDDISSKYVPPHVNIFYCLGGITLVCFIIQFATGFA MTFYYKPSVTEAFTSVQYLMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKNP RELTWITGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPLVGPLMVELIRGSA SVGQATLTRFYSLHTFVLPWFIAVFMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody
PA91390HU-01 50 µg

Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody
PA91390HU-02 100 µg

Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody
PA91390HU-03 500 µg

Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody
PA91390HU-04 1 mg

Rabbit anti-Human Microtubule Associated Protein 1 Light Chain 3 Alpha (MAP1LC3A) polyclonal antibody

Sign In for Pricing
View Details
KRV-VP1 + KRV-VP2 (C-terminus) Polyclonal Antibody, Cy3 Conjugated
bs-4642R-Cy3-TR 20 µL

KRV-VP1 + KRV-VP2 (C-terminus) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Nitrobacter winogradskyi Transcriptional repressor NrdR (nrdR)
MBS1301585-01 0.02 mg (E-Coli)

Recombinant Nitrobacter winogradskyi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details