Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-7 protein (GJB7)

This Recombinant Human Gap junction beta-7 protein (GJB7) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Gap junction beta-7 protein, Connexin-25, Cx25

UniProt

Q6PEY0

Expression Region

1-223

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGC KNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGL WYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI LFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF568 conjugate, 0.1mg/mL
BNC681864-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti Human ASF1A Polyclonal
Y054886 100 µL

Anti Human ASF1A Polyclonal

Sign In for Pricing
View Details
Stability Test Chamber BTST-1604
BTST-1604 1 Unit

Stability Test Chamber BTST-1604

Sign In for Pricing
View Details
Human DAB2IP activation kit by CRISPRa
GA115852 1 Kit

Human DAB2IP activation kit by CRISPRa

Sign In for Pricing
View Details
FOXO3 Human Gene Knockout Kit (CRISPR)
KN402894 1 Kit

FOXO3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AHSA1 Polyclonal Antibody
E-AB-63041-01 60 µL

AHSA1 Polyclonal Antibody

Sign In for Pricing
View Details