Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Voltage-dependent calcium channel gamma-1 subunit (Cacng1)

This Recombinant Rat Voltage-dependent calcium channel gamma-1 subunit (Cacng1) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Voltage-dependent calcium channel gamma-1 subunit, Dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma

UniProt

P97707

Expression Region

1-223

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQTKTAKVRVTLFFILAGGVLAMVAVVTDHWAVLSPHLEHHNETCVAAHFGLWRICTTW VAMHNQDKNCDGTIPAGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFII IGSICAFLSFGNKRDYLLRPASMFYAFAGLCLIVSVEVMRQSVKRMIDSEDTVWIEYYYS WSFACACAGFTLLFLGGLFLLLFSLPRMPQNPWESCMDTESEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF594 conjugate, 0.1mg/mL
BNC940674-100 1x 100 µL

Cytokeratin 10 (LH2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details