Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Nitrate reductase gamma chain (narI)

This Recombinant Bacillus subtilis Nitrate reductase gamma chain (narI) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Nitrate reductase gamma chain, EC= 1.7.99.4

UniProt

P42177

Expression Region

1-223

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGQILWGIMPYIVLTIFIGGHIYRYQHDQFGWTAKSSELLEKKKLAAGSTLFHWGLLCV VGGHVMGILIPEGVYASLGISEHMYHKMAIGAGLPAGIAACTGLVILTYRRLFDKRIRKT SSPSDILTLLLLLFMMLSGVAATFLNIDSKGFDYRTTVGPWFREIVLFRPDASLMESVPL WFKFHIVIGYVVFILWPFTRLVHVFSLPLKYLTRSYVVYRKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin F Polyclonal Antibody
E-AB-14906-01 20 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-02 60 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-03 120 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-04 200 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
ODZ3 (TENM3) Human Gene Knockout Kit (CRISPR)
KN416952 1 Kit

ODZ3 (TENM3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Septin 2 (SEPT2) Human Knockdown Lysate
LY300427 100 µg

Septin 2 (SEPT2) Human Knockdown Lysate

Sign In for Pricing
View Details