Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar biosynthetic protein fliP (fliP)

This Recombinant Flagellar biosynthetic protein fliP (fliP) spans the amino acid sequence from region 22-245.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliP

UniProt

P0AC06

Expression Region

22-245

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QLPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGTP SAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALEKGAQPLREFMLRQ TREADLGLFARLANTGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIA SVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSFYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 beta (S100B) Mouse Monoclonal Antibody [Clone ID: OTI3G6]
CF807235 100 µg

S100 beta (S100B) Mouse Monoclonal Antibody [Clone ID: OTI3G6]

Sign In for Pricing
View Details
Caspase 10 (CASP10) Human Gene Knockout Kit (CRISPR)
KN206379BN 1 Kit

Caspase 10 (CASP10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CoCoA (CALCOCO1) (NM_001143682) Human Over-expression Lysate
LC428318 20 µg

CoCoA (CALCOCO1) (NM_001143682) Human Over-expression Lysate

Sign In for Pricing
View Details
1-[(6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-yl)carbonyl]piperidine
TRC-F591020-500MG 500 mg

1-[(6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-yl)carbonyl]piperidine

Sign In for Pricing
View Details
RAF1 pSer43 Rabbit Polyclonal Antibody
AP12784PU-N 400 µL

RAF1 pSer43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse LIFR/CD118 Protein (His Tag)
PKSM040688 100 µg

Recombinant Mouse LIFR/CD118 Protein (His Tag)

Sign In for Pricing
View Details