Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_17983 (OsI_17983)

This Recombinant Oryza sativa subsp. indica CASP-like protein OsI_17983 (OsI_17983) spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

CASP-like protein OsI_17983

UniProt

B8ART0

Expression Region

1-224

Origin

Oryza sativa subsp. indica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSGEPAAVSIPIHDHHGKAPATSSAVPAAAAAAPAAAPAVAPRKVGIPFFRRGDHHRGS RCLAFLDFILRIAAFGPALAAAISTGTSDETLSVFTEFYQFRARFDDFPAFLFFLVANAI VAGYLVLSLPFSAVLVIRPQTIGLRLLLLVCDMIMAAMLTAAASAAAAIVDLAHNGNLRA NWVAICMQFHGFCQRTSGSVVASFLTVVILMFLVILAACSIRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-100 1x 100 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117), CF488A conjugate, 0.1mg/mL
BNC880476-100 1x 100 µL

CD79a (JCB117), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details