Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-19 (CLDN19)

This Recombinant Human Claudin-19 (CLDN19) spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

Claudin-19

UniProt

Q8N6F1

Expression Region

1-224

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI AGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGS FLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WHAMMP3 (NM_001045545) Human Over-expression Lysate
LC420755 20 µg

WHAMMP3 (NM_001045545) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Atp2a2 activation kit by CRISPRa
GA200321 1 Kit

Mouse Atp2a2 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl Heptanoate(Heptanoic Acid Ethyl Ester)
TRC-H998460-1G 1 g

Ethyl Heptanoate(Heptanoic Acid Ethyl Ester)

Sign In for Pricing
View Details
ENaC beta Antibody: APC
SMC-241D-APC 100 µg

ENaC beta Antibody: APC

Sign In for Pricing
View Details
TNF Antibody
KC-1796-01 50 μL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-1796-02 100 µL

TNF Antibody

Sign In for Pricing
View Details