Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptogyrin-2 (Syngr2)

This Recombinant Rat Synaptogyrin-2 (Syngr2) spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

Synaptogyrin-2, Cellugyrin

UniProt

O54980

Expression Region

1-224

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESGAYGAANAGGSFDLRRYVSQPQVVTRLVSMVLALIVFSCIFGEGYINLHSSDQLHCV FNRNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKPDDVLVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQN YVDPTPDPTTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wasf1 Mouse Gene Knockout Kit (CRISPR)
KN519313 1 Kit

Wasf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB504312 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Human Endothelin 1 (EDN1) ELISA Kit
RD-EDN1-Hu-01 96 Tests

Human Endothelin 1 (EDN1) ELISA Kit

Sign In for Pricing
View Details
Human Endothelin 1 (EDN1) ELISA Kit
RD-EDN1-Hu-02 48 Tests

Human Endothelin 1 (EDN1) ELISA Kit

Sign In for Pricing
View Details
2-Hydroxy-5-iodobenzoic acid
TRC-H943630-25G 25 g

2-Hydroxy-5-iodobenzoic acid

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Antibody
KC-32161-01 50 μL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details