Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 225 (TMEM225)

This Recombinant Human Transmembrane protein 225 (TMEM225) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Transmembrane protein 225

UniProt

Q6GV28

Expression Region

1-225

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPE DDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILY HNKLKQGQSMHFSNYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNE CKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Tolyl Sulfate-d7 Potassium Salt
TRC-T536802-25MG 25 mg

p-Tolyl Sulfate-d7 Potassium Salt

Sign In for Pricing
View Details
PLEKHM3 Human Gene Knockout Kit (CRISPR)
KN419590 1 Kit

PLEKHM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human β-EP (Beta-Endorphin) ELISA Kit
E-EL-H0572-01 24 Tests

Human β-EP (Beta-Endorphin) ELISA Kit

Sign In for Pricing
View Details
Human β-EP (Beta-Endorphin) ELISA Kit
E-EL-H0572-02 48 Tests

Human β-EP (Beta-Endorphin) ELISA Kit

Sign In for Pricing
View Details
Human β-EP (Beta-Endorphin) ELISA Kit
E-EL-H0572-03 96 Tests

Human β-EP (Beta-Endorphin) ELISA Kit

Sign In for Pricing
View Details
PTP1B (PTPN1) Rabbit Polyclonal Antibody
AP15219PU-N 400 µL

PTP1B (PTPN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details