Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig CD9 antigen (CD9)

This Recombinant Pig CD9 antigen (CD9) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

CD9 antigen, CD_antigen= CD9

UniProt

Q8WMQ3

Expression Region

2-226

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNNSSFYTGVYIL IGAGALMMVVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDQVIKEVQD FYRDTYNKLKGKDDPQRETLKAIHYALDCCGLMGEVEQLLADICPQRDVLSSLPMKPCPE AIKEVFQNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMD1 Protein Vector (Rat) (pPB-N-His)
PV253391 500 ng

AMD1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
RBL2 (Phospho-Ser639) Antibody
12697-01 50 µL

RBL2 (Phospho-Ser639) Antibody

Sign In for Pricing
View Details
RBL2 (Phospho-Ser639) Antibody
12697-02 100 µL

RBL2 (Phospho-Ser639) Antibody

Sign In for Pricing
View Details
GRAMD2A CytoSection
TS420145P5 25 Slides

GRAMD2A CytoSection

Sign In for Pricing
View Details
CTGE9 rabbit pAb Antibody
orb2305628-01 50 µL

CTGE9 rabbit pAb Antibody

Sign In for Pricing
View Details
CTGE9 rabbit pAb Antibody
orb2305628-02 100 µL

CTGE9 rabbit pAb Antibody

Sign In for Pricing
View Details