What is the catalog number for Recombinant Bovine CD9 antigen (CD9)?

The catalog number for Recombinant Bovine CD9 antigen (CD9) is orb2917759.

What sizes are available for Recombinant Bovine CD9 antigen (CD9)?

Recombinant Bovine CD9 antigen (CD9) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Bovine CD9 antigen (CD9) come in?

Recombinant Bovine CD9 antigen (CD9) is available in 2 different pack sizes.

Is Recombinant Bovine CD9 antigen (CD9) in stock?

Recombinant Bovine CD9 antigen (CD9) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Bovine CD9 antigen (CD9)

This Recombinant Bovine CD9 antigen (CD9) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

CD9 antigen, CD_antigen= CD9

UniProt

P30932

Expression Region

2-226

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVKGGTKCIKYLLFGFNFIFWLAGIAVLSVGLWLRFDSQTKSIFEQENNDSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFSFLLVIFAIEVAAAIWGYSHKEEVIKEVQK FYEDTYNKLKNKDEPQRETLKAIHIALDCCGLTGVPEQFLTDTCPPKNLIDSLKTRPCPE AIDEIFRSKFHIIGAVGIGIAVVMIFGMVFSMILCCAIRRNRDMV