Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat CD9 antigen (CD9)

This Recombinant Cat CD9 antigen (CD9) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

CD9 antigen, CD_antigen= CD9

UniProt

P40239

Expression Region

2-226

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVKGGTKCIKYLLFGFNFIFWLAGIAVLAVGLWLRFDSQTKSIFEQDSQPSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIQEVQE FYKDTYNKLKSKDEPQRDTLKAIHYALDCCGLAGGVEQFISDICPQKDILSSITVKPCPE AIKEVFHNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mastoparan
B6627-5 5 mg

Mastoparan

Sign In for Pricing
View Details
IL17E Rabbit Polyclonal Antibody
JOT-AP03090-01 50ul

IL17E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL17E Rabbit Polyclonal Antibody
JOT-AP03090-02 100ul

IL17E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 750) discontinued
214895-ML750 100 µL

HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GOT2 Rabbit Polyclonal Antibody
orb1742243 100 µL

GOT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Klhl1 Antibody - N-terminal region : HRP (ARP34466_P050-HRP)
ARP34466_P050-HRP 100 µL

Klhl1 Antibody - N-terminal region : HRP (ARP34466_P050-HRP)

Sign In for Pricing
View Details