Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat CD9 antigen (CD9)

This Recombinant Cat CD9 antigen (CD9) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

CD9 antigen, CD_antigen= CD9

UniProt

P40239

Expression Region

2-226

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVKGGTKCIKYLLFGFNFIFWLAGIAVLAVGLWLRFDSQTKSIFEQDSQPSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIQEVQE FYKDTYNKLKSKDEPQRDTLKAIHYALDCCGLAGGVEQFISDICPQKDILSSITVKPCPE AIKEVFHNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-RPL9 Antibody
DL96231A-01 50 µL

Rabbit anti-RPL9 Antibody

Sign In for Pricing
View Details
Rabbit anti-RPL9 Antibody
DL96231A-02 100 µL

Rabbit anti-RPL9 Antibody

Sign In for Pricing
View Details
Tyro3 Lentiviral Activation Particles (h2)
sc-401412-LAC-2 200 µL

Tyro3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
ZNF224 Human shRNA Lentiviral Particle (Locus ID 7767)
TL308213V 500 µL Each

ZNF224 Human shRNA Lentiviral Particle (Locus ID 7767)

Sign In for Pricing
View Details
Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone
RG229860 10 µg

Manic Fringe (MFNG) (NM_001166343) Human Tagged ORF Clone

Sign In for Pricing
View Details
Apoptosis Regulator Bcl-X (BCLX) Antibody
abx121848-01 30 µL

Apoptosis Regulator Bcl-X (BCLX) Antibody

Sign In for Pricing
View Details