Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat CD9 antigen (CD9)

This Recombinant Cat CD9 antigen (CD9) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

CD9 antigen, CD_antigen= CD9

UniProt

P40239

Expression Region

2-226

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVKGGTKCIKYLLFGFNFIFWLAGIAVLAVGLWLRFDSQTKSIFEQDSQPSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIQEVQE FYKDTYNKLKSKDEPQRDTLKAIHYALDCCGLAGGVEQFISDICPQKDILSSITVKPCPE AIKEVFHNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbx3 (NM_001008313) Rat Tagged ORF Clone
RR201553 10 µg

Cbx3 (NM_001008313) Rat Tagged ORF Clone

Sign In for Pricing
View Details
OLAH (NM_018324) Human Tagged ORF Clone
RG219627 10 µg

OLAH (NM_018324) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Gtf2h3 (NM_181410) AAV Particle
MR204372A1V 250 µL

Mouse Gtf2h3 (NM_181410) AAV Particle

Sign In for Pricing
View Details
ARHGAP25, ID (ARHGAP25, KIAA0053, Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25) (MaxLight 550)
MBS6274892-01 0.1 mL

ARHGAP25, ID (ARHGAP25, KIAA0053, Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25) (MaxLight 550)

Sign In for Pricing
View Details
ARHGAP25, ID (ARHGAP25, KIAA0053, Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25) (MaxLight 550)
MBS6274892-02 5x 0.1 mL

ARHGAP25, ID (ARHGAP25, KIAA0053, Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25) (MaxLight 550)

Sign In for Pricing
View Details
PPP4R3B Rabbit pAb (APR29697N)
APR29697N-01 50 µL

PPP4R3B Rabbit pAb (APR29697N)

Sign In for Pricing
View Details