Recombinant Callithrix jacchus Insulin-induced gene 2 protein (INSIG2)
This Recombinant Callithrix jacchus Insulin-induced gene 2 protein (INSIG2) spans the amino acid sequence from region 1-225.
Product Specifications
Product Name Alternative
Insulin-induced gene 2 protein, INSIG-2
UniProt
B0CMA4
Expression Region
1-225
Origin
Callithrix jacchus (White-tufted-ear marmoset)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVEEETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFNREWSNVMRCVAVFVGINH ASAKLDFDNNIQLSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400050-100 1x 100 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC551037-100 1x 100 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details